ELISA Recombinant Tropheryma whipplei UPF0233 membrane protein TW010 (TW010)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Tropheryma whipplei (strain TW08/27) (Whipple's bacillus) Uniprot NO.:P67379 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSRKKHESSENNPVWFPTIMFGLMGTGAVWMVLFYISNGALPLPAVGTWNILIAFGIIMA GFAMMSRWK Protein Names:Recommended name: UPF0233 membrane protein TW010 Gene Names:Ordered Locus Names:TW010 Expression Region:1-69 Sequence Info:fµLl length protein