Se rendre au contenu

ELISA Recombinant Danio rerio Sterol regulatory element-binding protein 2(srebf2)

https://assay.labm.com/web/image/product.template/123594/image_1920?unique=c41145e
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Danio rerio (Zebrafish) (Brachydanio rerio) Uniprot NO.:A3KNA7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDASEFMDTMDPSLSELGDEFTLGDIDEmLQFVSNQVDFPDIFEDQMGGGATARTLPQAV PSAILTPPHTPVQTSSQTHTQTLTQAHTQTHTQTHTQTRTPPVLQPRPQPITQVQTQTFP MQTLAVQTQAQPQTVMITPTATPSRFIQNQVICQQNNATSFQVLQPQMQSIMTSPQVQPM TIQHQRVLTPAGQTIQTLSTAPTTVHTMSQQVPVLVHQPQILKTDSLLLTTKPDGTQVLS TVQSPTGITTLTTPIQTTALQMPTLMSSNILTTVPVVMGGGDKLPIKQLSSGPAHNIGGA RVGVEQSPVVGPGGVVKEGERRTTHNIIEKRYRSSINDKILELRDLVLGNDAKMHKSGVL RKAIDYIKYLQQVNHKLRQENLTLKMANQKNKSACVSDVDLELKAEVSLISPPPSDSGSS SPAQLSPYCIDSEPGSPLLEHEQLKSEPDSPSCVGVMDRSRLLL Protein Names:Recommended name: Sterol regµLatory element-binding protein 2 Short name= SREBP-2 Alternative name(s): Sterol regµLatory element-binding transcription factor 2 Cleaved into the following chain: 1. Processed sterol regµLatory element-bin Gene Names:Name:srebf2 ORF Names:zgc:158371 Expression Region:1-464 Sequence Info:fµLl length protein

1.825,00 € 1825.0 EUR 1.825,00 € Hors taxes

1.825,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF022658DIL
URL de site web: /shop/csb-cf022658dil-elisa-recombinant-danio-rerio-sterol-regulatory-element-binding-protein-2-srebf2-123594

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.