Se rendre au contenu

ELISA Recombinant Zaglossus bruijni NADH-ubiquinone oxidoreductase chain 1(MT-ND1)

https://assay.labm.com/web/image/product.template/162103/image_1920?unique=7c948e0
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zaglossus bruijni (Long-beaked echidna) Uniprot NO.:O78713 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ILLAVAFLTLIERKILGYMQFRKGPNIVGPHGLLQPIADAVKLFIKEPLRPMTSSIYMFI LAPILALSLALTIWVPLPMPLPLIDLNLGLLFVLSVSGLSVYSILWSGWASNSKYALTGA LRAVAQTISYEVTLAIILLSImLINGSFTLTTLNLTQEFMWLVVPTWPLmLTRFISTLAE TNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIIIMNALTVILFFGAYHLIFLP ELSTINFMIKTMmLTSLFLWIRASYPRFRYDQLMHLLWKNFLPITLVTCLWFImLPLALS WIP Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 1 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 1 Gene Names:Name:MT-ND1 Synonyms:MTND1, NADH1, ND1 Expression Region:1-303 Sequence Info:fµLl length protein

1.655,00 € 1655.0 EUR 1.655,00 € Hors taxes

1.655,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF015076ZAR-GB
URL de site web: /shop/csb-cf015076zar-gb-elisa-recombinant-zaglossus-bruijni-nadh-ubiquinone-oxidoreductase-chain-1-mt-nd1-162103

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.