ELISA Recombinant Macaca mulatta Melanin-concentrating hormone receptor 2(MCHR2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Macaca mµLatta (Rhesus macaque) Uniprot NO.:Q8MJ88 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNPFHSSCWNTSAELSNKSWNKEFAYQTASVVDTVILPSMIGIICSTGLVGNILIVFTII RSRKKTVPDIYICNLAVADLVHIIGMPFLIHQWARGGEWVFGGPLCTIITSLDTCNQFAC SAIMTVMSVDRYFALVQPFRLTSWRTRYKTIRINLGLWAASFVLALPVWIYSKVIKFKDG VESCAFDLTSPDDVLWYTLYLTITTFFFPLPLILVCYILILCYTWEMYQQNKDARCCNPS VPKQRVMKLTKMVLVLVAVFILSAAPYHVIQLVNLQMEQPTLAFYVGYYLSICLSYASSS INPFLYILLSGNFQKRLPQIQRRVTDKEIKNMGNTLKSHF Protein Names:Recommended name: Melanin-concentrating hormone receptor 2 Short name= MCH receptor 2 Short name= MCH-R2 Short name= MCHR-2 Alternative name(s): G-protein coupled receptor 145 MCH-2R Short name= MCH2 Short name= Gene Names:Name:MCHR2 Synonyms:GPR145 Expression Region:1-340 Sequence Info:fµLl length protein