ELISA Recombinant Macaca mulatta Melanin-concentrating hormone receptor 2(MCHR2)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Macaca mµLatta (Rhesus macaque)
Uniprot NO.:Q8MJ88
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNPFHSSCWNTSAELSNKSWNKEFAYQTASVVDTVILPSMIGIICSTGLVGNILIVFTII RSRKKTVPDIYICNLAVADLVHIIGMPFLIHQWARGGEWVFGGPLCTIITSLDTCNQFAC SAIMTVMSVDRYFALVQPFRLTSWRTRYKTIRINLGLWAASFVLALPVWIYSKVIKFKDG VESCAFDLTSPDDVLWYTLYLTITTFFFPLPLILVCYILILCYTWEMYQQNKDARCCNPS VPKQRVMKLTKMVLVLVAVFILSAAPYHVIQLVNLQMEQPTLAFYVGYYLSICLSYASSS INPFLYILLSGNFQKRLPQIQRRVTDKEIKNMGNTLKSHF
Protein Names:Recommended name: Melanin-concentrating hormone receptor 2 Short name= MCH receptor 2 Short name= MCH-R2 Short name= MCHR-2 Alternative name(s): G-protein coupled receptor 145 MCH-2R Short name= MCH2 Short name=
Gene Names:Name:MCHR2 Synonyms:GPR145
Expression Region:1-340
Sequence Info:fµLl length protein
Référence interne:
CSB-CF013585MOW
URL de site web:
/shop/csb-cf013585mow-elisa-recombinant-macaca-mulatta-melanin-concentrating-hormone-receptor-2-mchr2-142520
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.