ELISA Recombinant Papio anubis Insulin-induced gene 2 protein(INSIG2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Papio anubis (Olive baboon) Uniprot NO.:A9RA88 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPP DVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH ASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATLVTQLLVYNGVYQY TSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE Protein Names:Recommended name: InsµLin-induced gene 2 protein Short name= INSIG-2 Gene Names:Name:INSIG2 Expression Region:1-225 Sequence Info:fµLl length protein