ELISA Recombinant Protein cornichon homolog(CNIH)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O95406 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAFTFAAFCYmLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHA FFCVMFLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGW CKLAFYLLAFFYYLYGMIYVLVSS Protein Names:Recommended name: Protein cornichon homolog Alternative name(s): T-cell growth-associated molecµLe 77 Short name= TGAM77 Gene Names:Name:CNIH Synonyms:CNIL ORF Names:UNQ155/PRO181 Expression Region:1-144 Sequence Info:FµLl length protein