ELISA Recombinant Methanothermobacter marburgensis F420-dependent NADP reductase(fno)

Quantity: 20µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 25-35 working days Research Topic: Others Uniprot ID: D9PVP5 Gene Names: fno Organism: Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg) (Methanobacterium thermoautotrophicum) AA Sequence: MKIAVLGGTGDQGLGLALRLALAGEEVIIGSRDAEKAVSAAQKVLEIAERDDLKVKGATNAEAAEEAEVAILTVPLQAQMATLGSVKEAIKGKVLIDATVPIDSCLGGSAVRYIDLWDGSAAERAARFLEDQGTRVAAAFNNISASALLDITGPVDCDCLIASDHRDALDLASELAEKIDGVRAIDCGGLENARVIEKITPLLINLNIKNRIRNAGIRITNLPE Expression Region: 1-224aa Sequence Info: FµLl Length Source: BacµLovirus Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged MW: 27.4 kDa Alternative Name(s): F420H2:NADP oxidoreductase Relevance: Catalyzes the reduction of NADP+ with F420H2 via hydride transfer, and the reverse reaction, i.e. the reduction of F420 with NADPH. Probably functions in the regeneration of NADPH required in biosynthetic reactions. Reference: "F420H2:NADP oxidoreductase from Methanobacterium thermoautotrophicum: identification of the encoding gene via functional overexpression in Escherichia coli." Berk H., Thauer R.K. FEBS Lett. 438:124-126(1998) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.