ELISA Recombinant Aequorea victoria Green fluorescent protein(GFP)

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Others Target / Protein: GFP Biologically active: Not Tested Expression system: E.coli Species of origin: Aequorea victoria (Jellyfish) Delivery time: 3-7 business days Uniprot ID: P42212 AA Sequence: MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 1-238aa Protein length: FµLl Length MW: 42.9 kDa Alternative Name(s): Relevance: Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca2+-activated photoprotein aequorin. Reference: "A molecµLar thermometer based on fluorescent protein blinking."Wong F.H., Banks D.S., Abu-Arish A., Fradin C.J. Am. Chem. Soc. 129:10302-10303(2007) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.