ELISA Recombinant Putative G-protein coupled receptor GPCR39
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Homo sapiens ()
Uniprot NO.:Q8NGA4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNGVSEGTRGCSDRQPGALTQGHSCSRKMNASRCLSEEVGSLRPLTMAVLSASFVVGVLG NGLVPWVTVFRMARTVSTVCFFHLALADFmLSLSLPILVYYIVSRQWLLGEWACKLYTGF VFLTFSTSNCLLVLISVDRCISVLYPVWALNHRTEQRASWLAFGVWLLAAALCSAHLKFR TTRKWNGCMQCYLQFNLENETAQMWTQEVFGRQMAVIMAHFLLGFLGPLAIIGTCAHLIR AKLLREGWVHANRPKRLLLVLVSALSAGSHLT
Protein Names:Recommended name: Putative G-protein coupled receptor GPCR39 Short name= hGPCR39
Gene Names:
Expression Region:1-272
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF850885HU
Website URL:
/shop/csb-cf850885hu-elisa-recombinant-putative-g-protein-coupled-receptor-gpcr39-137900
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our latest content
Check out what's new in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.