ELISA Recombinant Psychrobacter cryohalolentis UPF0059 membrane protein Pcryo_0007(Pcryo_0007)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Psychrobacter cryohalolentis (strain K5)
Uniprot NO.:Q1QEW2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDIEMIEVILLAIALAMDAFAVSIGLGAKSQKQSSAYVLRLAVYAALYFGIAQGVMPLIG YLLGAVLLGWLATAAPWLGGGILILLGAKmLYEAFNGEIEAVLEDSFDRNMQEKINHRMM FTLAIATSIDAMAAGFTLNLLALNAWLACSIIAIVTAGFGFFGIYLGKSSGTWLEDKAEI LGGLVLIAIGIKVMFIR
Protein Names:Recommended name: UPF0059 membrane protein Pcryo_0007
Gene Names:Ordered Locus Names:Pcryo_0007
Expression Region:1-197
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF629942PAAM
Website URL:
/shop/csb-cf629942paam-elisa-recombinant-psychrobacter-cryohalolentis-upf0059-membrane-protein-pcryo-0007-pcryo-0007-151377
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our latest content
Check out what's new in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.