ELISA Recombinant ER lumen protein retaining receptor(ERD2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Plasmodium falciparum Uniprot NO.:P33948 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNIFRLIGDILHLVSMYILIMKLKKSKNCIGISCRMQELYLIVFLCRYIDLFFVFVSFYN TVMKITFILTIAYTIYLIRLKLPISQTYNRKVDNFKSEKYLIPPCLVLSLLTCKTYNLYN ILWSFSIWLESVAILPQLVLLEKQREVENITSHYVITMGLYRAFYILNWIYRYFFDDKPY INVVGWIGGLIQTLLYIDFFYYFALAKWYGKKLVLPFNGEV Protein Names:Recommended name: ER lumen protein retaining receptor Gene Names:Name:ERD2 Expression Region:1-221 Sequence Info:fµLl length protein