ELISA Recombinant Natural cytotoxicity triggering receptor 1(NCR1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O76036 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL Protein Names:Recommended name: Natural cytotoxicity triggering receptor 1 Alternative name(s): Lymphocyte antigen 94 homolog NK cell-activating receptor Natural killer cell p46-related protein Short name= NK-p46 Short name= NKp46 Short name= hNKp46 CD_antigen= CD335 Gene Names:Name:NCR1 Synonyms:LY94 Expression Region:22-304 Sequence Info:fµLl length protein