ELISA Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 7(PCR7)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q9LS43 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEKQWTSGLFSCMEDSETACLTCFCPCVTFGRIADISDEGRTGCGRCGVFYGLICCVVGL PCLFSCTYRTKIRSKFGLPESPTSDCVTHFFCECCALCQEHRELKTRGLDPSIGWSGNMQ RTMAPPMSQQMMG Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 7 Short name= AtPCR7 Gene Names:Name:PCR7 Ordered Locus Names:At3g18470 ORF Names:MYF24.19 Expression Region:1-133 Sequence Info:fµLl length protein