ELISA Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 11(PCR11)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q9SX24 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNLSSNDQPSQGRIKAKDWSTDLCECWMDINSCCLTCWCPCVAFGRIAEVVDRGSTSCGV SGAMYMIIFmLTGYGGSSLYSCFYRTKLRAQYNLKERPCCDCCVHFCCEPCALCQEYRQL QHNRDLDLVIGWHGNMERHARLAASTPSAPPLQAPMSRLV Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 11 Short name= AtPCR11 Gene Names:Name:PCR11 Ordered Locus Names:At1g68610 ORF Names:F24J5.15 Expression Region:1-160 Sequence Info:fµLl length protein