Se rendre au contenu

ELISA Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 6(PCR6)

https://assay.labm.com/web/image/product.template/117046/image_1920?unique=a9584cd
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q9M9A5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGRPDQTPSPRMNNNFNPVFHAQSEQPVDEKRVLQAEQIYPNNGGVVNQPNQVPMRPGPP TYINQSATFNQPYGVSMAGPVHTQPSNWTSGLFDCMNDGENALITCCFPFVTFGQIAEVI DEGATSCGTAGmLYGLICCLFAIPCVYTCTFRTKLRSKYGLPDAPAPDWITHCFCEYCAL CQEYRELKNRGLDPSIGWIGNVQKQRMGQQQEMMAPPMGQRMMG Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 6 Short name= AtPCR6 Gene Names:Name:PCR6 Ordered Locus Names:At1g49030 ORF Names:F27J15.18 Expression Region:1-224 Sequence Info:fµLl length protein

1.571,00 € 1571.0 EUR 1.571,00 € Hors taxes

1.571,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF864963DOA
URL de site web: /shop/csb-cf864963doa-elisa-recombinant-arabidopsis-thaliana-protein-plant-cadmium-resistance-6-pcr6-117046

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.