Se rendre au contenu

ELISA Recombinant Staphylococcus epidermidis Lipoteichoic acid synthase(ltaS)

https://assay.labm.com/web/image/product.template/158700/image_1920?unique=b3f4f0f
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Staphylococcus epidermidis (strain ATCC 12228) Uniprot NO.:Q8CQ10 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SEDDLTKVLNYTKQKRTEPNPEYYGAAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSSGNQDFTYFPNFFHQTGQGKTSDSEFTMDNSLYGLPQGSAYSLKGDNTYQSLPAILDQ KQGYTSNVMHGDYKTFWNRDQVYKHFGIDNFYDATYYDMSDDNIVNLGLKDKPFFKASAD YQSKMKKPFYSHLITLTNHYPFTLDEEDASIDKPNTGDSTVDGYIQTAHYLDQALEEYIT DLKKKGLYDNSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFTDLNRTGFWLKVPGKSG GVNKEYAGQMDVMPTLLHLVGIDSKNYLMFGSDMFSKQHNNVVPFRNGDFITEDYKYVNG KIYSNKDNELLTEKPKDFDKNKKQVEKDLEMSDSVLNGDLFRFYKNPDFKKVNPGKYEYK SGPKGNEKK Protein Names:Recommended name: Lipoteichoic acid synthase Cleaved into the following 2 chains: 1. Glycerol phosphate lipoteichoic acid synthase Short name= 2. LTA synthase EC= 3. 2.7.8.- Alternative name(s): Polyglycerol phosphate synthase Gene Names:Name:ltaS Ordered Locus Names:SE_0494 Expression Region:218-646 Sequence Info:fµLl length protein

1.788,00 € 1788.0 EUR 1.788,00 € Hors taxes

1.788,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF815934SLD
URL de site web: /shop/csb-cf815934sld-elisa-recombinant-staphylococcus-epidermidis-lipoteichoic-acid-synthase-ltas-158700

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.