ELISA Recombinant Haemophilus influenzae UPF0299 membrane protein CGSHiGG_01475 (CGSHiGG_01475)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Haemophilus influenzae (strain PittGG) Uniprot NO.:A5UF21 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIQKLFLLVRSLVILSImLYLGNLIAYYIPSGVPGSIWGLLLLFLGLTTRVIHLNWIYLG ASLLIRFMAVLFVPVSVGIIKYSDLLIEQINILLVPNIVSTCVTLLVIGFLGHYLYQMQS FTHKRKKVIKRRENQVKQAN Protein Names:Recommended name: UPF0299 membrane protein CGSHiGG_01475 Gene Names:Ordered Locus Names:CGSHiGG_01475 Expression Region:1-140 Sequence Info:fµLl length protein