ELISA Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 3(PCR3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:P0CW97 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASQHLQANPHAEGEWSTGFCDCFSDCQNCCITWLCPCITFGQVADIVDRGNTSCGTAGA LYVLLAAITGCGCLYSCIYRGKIRAQYNIRGDGCTDCLKHFCCELCALTQEYRELKHRGF DMSLGWAGNVEKQQNQGGVAMGAPAFQGGMSR Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 3 Short name= AtPCR3 Gene Names:Name:PCR3 Ordered Locus Names:At5g35525 ORF Names:MOK9 Expression Region:1-152 Sequence Info:fµLl length protein