Se rendre au contenu

ELISA Recombinant Rat IgG receptor FcRn large subunit p51(Fcgrt)

https://assay.labm.com/web/image/product.template/152402/image_1920?unique=45d657d
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P13599 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AEPRLPLMYHLAAVSDLSTGLPSFWATGWLGAQQYLTYNNLRQEADPCGAWIWENQVSWYWEKETTDLKSKEQLFLEAIRTLENQINGTFTLQGLLGCELAPDNSSLPTAVFALNGEEFMRFNPRTGNWSGEWPETDIVGNLWMKQPEAARKESEFLLTSCPERLLGHLERGRQNLEWKEPPSMRLKARPGNSGSSVLTCAAFSFYPPELKFRFLRNGLASGSGNCSTGPNGDGSFHAWSLLEVKRGDEHHYQCQVEHEGLAQPLTVDLDSPARSSVPVVGIILGLLLVVVAIAGGVLLWNRMRSGLPAPWLSLSGDDSGDLLPGGNLPPEAEPQGVNAFPATS Protein Names:Recommended name: IgG receptor FcRn large subunit p51 Short name= FcRn Alternative name(s): IgG Fc fragment receptor transporter alpha chain Neonatal Fc receptor Gene Names:Name:Fcgrt Synonyms:Fcrn Expression Region:23-366 Sequence Info:fµLl length protein

1.698,00 € 1698.0 EUR 1.698,00 € Hors taxes

1.698,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

This content will be shared across all product pages.


Hieff NGS

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF008545RA
URL de site web: /shop/csb-cf008545ra-elisa-recombinant-rat-igg-receptor-fcrn-large-subunit-p51-fcgrt-152402

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.